PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa009543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 227aa    MW: 26459.7 Da    PI: 10.2644
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58679423PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.3e-13114158347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ +++ + + +G+g+W+ I+r +  ++t+ q+ s+ qky
        Lsa009543 114 PWTEDEHRRFLMGLQVHGKGDWRNISRNFVVTKTPTQVASHAQKY 158
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.431267IPR017884SANT domain
SMARTSM007173.5E-71365IPR001005SANT/Myb domain
SuperFamilySSF466897.48E-111570IPR009057Homeodomain-like
CDDcd001671.88E-51663No hitNo description
PROSITE profilePS5129418.312107163IPR017930Myb domain
SuperFamilySSF466899.72E-16109162IPR009057Homeodomain-like
SMARTSM007171.0E-9111161IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.0E-17111162IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-10112158IPR009057Homeodomain-like
PfamPF002498.7E-11114158IPR001005SANT/Myb domain
CDDcd001671.93E-8114159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
METSNRLMMQ ESKSSKWTRE QNKWFESALA IFDTETPDRW SNVAALVPGK SEFEVRQQYE  60
ELKADINNIE AGLVPDPGYF TFKSELLQDR RFNSFGSRLF RSRSLDHERR KGIPWTEDEH  120
RRFLMGLQVH GKGDWRNISR NFVVTKTPTQ VASHAQKYFA RQHADGKEKR RPSIHDITTV  180
HLPRTTSFSG DMDKSSPLMV NTQNNGINIR VYNSGLFFQP TRYQVQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1717981193RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776702.14e-81PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016450782.14e-81PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-66DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A118K6081e-135A0A118K608_CYNCS; Homeodomain-like protein
STRINGGLYMA14G06750.13e-77(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.18e-70MYB family protein